PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_30069_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 718aa    MW: 79359.4 Da    PI: 6.2936
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_30069_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox629.1e-2052107156
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     +++ +++t+ q++e+e++F+++++p+ ++r+eL+++lgL+  qVk+WFqN+R+++k
  Neem_30069_f_1  52 KKRYHRHTQRQIQEMEAFFKECPHPDDKQRKELSRELGLEPLQVKFWFQNKRTQMK 107
                     688999***********************************************998 PP

2START181.93.5e-572414591206
                     HHHHHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S..EEEEEEEE CS
           START   1 elaeeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla..kaetlevi 85 
                     ela +a++el+++a+a+ep+W       e++n+de+l++f+++ +      ++ea+r+s vv+m++ +lve+l+d+++    +++       +  
  Neem_30069_f_1 241 ELAVAAMEELMRMAQAGEPLWIPGEnctEMLNEDEYLRTFPRGIGpkplgLRSEASRESSVVIMNHINLVEILMDVAK---SMVKcvLRYCFKSY 332
                     57899*****************999999**************999********************************5...44443312233444 PP

                     CTT.........EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEEEEECTCEEEEEEEE-E CS
           START  86 ssg.........galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwvehv 170
                     ++g             l +ae+q++splvp R+ +fvRy++q+++g+w++vdvS+ds ++ p    + +++++pSg+li++++ng+skv+wvehv
  Neem_30069_f_1 333 DPGspinrsrrkLQWSLASAEFQVPSPLVPtRENYFVRYCKQHPDGTWAVVDVSLDSLRPSP----ISKCRRRPSGCLIQELPNGYSKVIWVEHV 423
                     444555555644888899******************************************99....689999*********************** PP

                     E--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
           START 171 dlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                     ++++r++h+++r++v+ gla+gak+wvatl+rqce+
  Neem_30069_f_1 424 EVDDRSVHEIYRPVVNCGLAFGAKRWVATLDRQCER 459
                     **********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.8E-2237107IPR009057Homeodomain-like
SuperFamilySSF466892.38E-1938110IPR009057Homeodomain-like
PROSITE profilePS5007116.42249109IPR001356Homeobox domain
SMARTSM003898.5E-1950113IPR001356Homeobox domain
PfamPF000462.3E-1752107IPR001356Homeobox domain
CDDcd000867.75E-1952110No hitNo description
PROSITE patternPS00027084107IPR017970Homeobox, conserved site
SuperFamilySSF559614.58E-30232461No hitNo description
PROSITE profilePS5084835.703232462IPR002913START domain
CDDcd088754.15E-101236458No hitNo description
SMARTSM002342.3E-49241459IPR002913START domain
PfamPF018525.7E-47242459IPR002913START domain
Gene3DG3DSA:3.30.530.201.6E-4359458IPR023393START-like domain
SuperFamilySSF559615.8E-27479710No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009913Biological Processepidermal cell differentiation
GO:0048497Biological Processmaintenance of floral organ identity
GO:0048825Biological Processcotyledon development
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 718 aa     Download sequence    Send to blast
MFESDHMFDM TSKSSESDLG KLKDDDYETK SGTETMEIPS GDDQDPSQCP KKKRYHRHTQ  60
RQIQEMEAFF KECPHPDDKQ RKELSRELGL EPLQVKFWFQ NKRTQMKAQQ ERHENQILKA  120
ENEKLRAENN RYKEALGNAT CPNCGGPAAL GEMSFDEQHL RIENARLREE IDRISAIAAK  180
YVGKPLSSFP HLSSHLPSRS LDLGFNNLGT QSGFVGEMYG GGDLIRSISG PTEADKPMIV  240
ELAVAAMEEL MRMAQAGEPL WIPGENCTEM LNEDEYLRTF PRGIGPKPLG LRSEASRESS  300
VVIMNHINLV EILMDVAKSM VKCVLRYCFK SYDPGSPINR SRRKLQWSLA SAEFQVPSPL  360
VPTRENYFVR YCKQHPDGTW AVVDVSLDSL RPSPISKCRR RPSGCLIQEL PNGYSKVIWV  420
EHVEVDDRSV HEIYRPVVNC GLAFGAKRWV ATLDRQCERL ASSMASNIPA GDLCVITSPE  480
GRKSMLKLAE RMVTSFCTGV GASTAHAWTT LSATGSDDVR VMTRKSMDDP GRPPGIVLSA  540
ATSFWIPVPP KRVFDFLRDE NSRSEWDILS NGGLVQEMAH IANGREPGNC VSLLRVNSAN  600
SSQSNMLVLQ ESCTDSTGSY VIYAPVDIVA MNMVLSGGDP DYVALLPSGF AILPDGPGLN  660
GGRILEVGSG GSLLTVAFQI LVDSVPTAKL SLGSVATVNS LIKCTVERIK AAVMCDNA
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007026002.10.0Protodermal factor 2 isoform 1
RefseqXP_007026003.10.0Protodermal factor 2 isoform 1
RefseqXP_007026004.10.0Protodermal factor 2 isoform 1
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLA0A061GGE70.0A0A061GGE7_THECC; Protodermal factor 2 isoform 1
STRINGPOPTR_0004s01980.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM49128149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2